Protein Info for Atu1041 in Agrobacterium fabrum C58

Annotation: methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 PF01209: Ubie_methyltran" amino acids 22 to 141 (120 residues), 45.7 bits, see alignment E=2.5e-15 PF08003: Methyltransf_9" amino acids 29 to 141 (113 residues), 36.2 bits, see alignment E=1.6e-12 PF13489: Methyltransf_23" amino acids 36 to 178 (143 residues), 59.7 bits, see alignment E=1.4e-19 PF01728: FtsJ" amino acids 40 to 115 (76 residues), 26.3 bits, see alignment E=2.9e-09 PF02353: CMAS" amino acids 42 to 141 (100 residues), 31.8 bits, see alignment E=4.3e-11 PF13847: Methyltransf_31" amino acids 42 to 142 (101 residues), 64.9 bits, see alignment E=3.3e-21 PF08241: Methyltransf_11" amino acids 47 to 141 (95 residues), 89.6 bits, see alignment E=7.8e-29 PF13649: Methyltransf_25" amino acids 47 to 137 (91 residues), 81.5 bits, see alignment E=2.8e-26 PF08242: Methyltransf_12" amino acids 47 to 138 (92 residues), 58.7 bits, see alignment E=3.7e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu1041)

Predicted SEED Role

"Methyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJK3 at UniProt or InterPro

Protein Sequence (244 amino acids)

>Atu1041 methyltransferase (Agrobacterium fabrum C58)
MKQNIYDDAGFFERYSAMPRSIEGLRQAGEWHELRAMLPDLKGRSFLDLGCGFGWHCRYA
AEQGAARIVGVDLSENMLRRAAEINGGPGIDYRRAAIEDIDFPRESFDVVLSSLALHYVR
DLDAAFAKIFAVLKAGGDFVFSIEHPVFTALEKQDWFYGEGGEILHWPLDNYQNEGVRHS
NWMADDVVKYHRTVSGILNGLLSAGFALTQLAEPRPDPALMAERPELKHEDRRPIFLIVG
AKKP