Protein Info for Atu1036 in Agrobacterium fabrum C58

Annotation: GTP-binding protein, Era family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 TIGR00436: GTP-binding protein Era" amino acids 21 to 291 (271 residues), 250.5 bits, see alignment E=2e-78 TIGR00231: small GTP-binding protein domain" amino acids 21 to 180 (160 residues), 79.3 bits, see alignment E=2.9e-26 PF02421: FeoB_N" amino acids 23 to 178 (156 residues), 44.4 bits, see alignment E=4.6e-15 PF01926: MMR_HSR1" amino acids 23 to 137 (115 residues), 81.8 bits, see alignment E=1.4e-26 PF10662: PduV-EutP" amino acids 23 to 180 (158 residues), 35.5 bits, see alignment E=3.1e-12 PF00009: GTP_EFTU" amino acids 23 to 185 (163 residues), 45.8 bits, see alignment E=1.9e-15 PF07650: KH_2" amino acids 220 to 296 (77 residues), 67.1 bits, see alignment E=3.5e-22

Best Hits

Swiss-Prot: 100% identical to ERA_AGRFC: GTPase Era (era) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03595, GTP-binding protein Era (inferred from 100% identity to atu:Atu1036)

Predicted SEED Role

"GTP-binding protein Era" in subsystem Bacterial Cell Division or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UGK1 at UniProt or InterPro

Protein Sequence (313 amino acids)

>Atu1036 GTP-binding protein, Era family (Agrobacterium fabrum C58)
MTDHENPAVTGEDNALPTRSGFVALIGPTNAGKSTLVNRLVGAKVSIVSHKVQTTRAVMR
GIAIHKNAQIVFMDTPGIFKPRRRLDRAMVTSAWGGAKDADLILLLIDSERGLKGDAEAI
LEGLKDVPQKKILCLNKIDQVKREDLLKLAAAANEKVAFDRTFMISATNGSGCEDLMDYL
VETLPEGPWYYPEDQISDLPMRQLAAEITREKLFLRLHQELPYASHVETEKWEERKDGSV
RIEQVIYVERDSQKKIALGKNGDAIKAISTASRKELSEILEQPVHLFLFVKVRENWGDDP
ERFREMGLEFPRG