Protein Info for Atu1009 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 112 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF09917: DUF2147" amino acids 61 to 111 (51 residues), 44.8 bits, see alignment E=8.6e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu1009)

Predicted SEED Role

"FIG00027233: possible membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D055 at UniProt or InterPro

Protein Sequence (112 amino acids)

>Atu1009 hypothetical protein (Agrobacterium fabrum C58)
MKRIMTIAAALMMSGNLAFAGEAIEGNWKTASGETAVIGPCGGAFCVTLKTGKHAGKQIG
KLSGKGNSYSGEITDPANDKTYSGSGTVSGNSLSMKGCVLKILCKSQTWTRL