Protein Info for Atu0999 in Agrobacterium fabrum C58

Annotation: magnesium transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 transmembrane" amino acids 281 to 301 (21 residues), see Phobius details amino acids 313 to 337 (25 residues), see Phobius details amino acids 355 to 376 (22 residues), see Phobius details amino acids 388 to 417 (30 residues), see Phobius details amino acids 429 to 453 (25 residues), see Phobius details PF03448: MgtE_N" amino acids 27 to 125 (99 residues), 55.1 bits, see alignment E=1.5e-18 TIGR00400: magnesium transporter" amino acids 27 to 452 (426 residues), 320.9 bits, see alignment E=6.4e-100 PF00571: CBS" amino acids 129 to 184 (56 residues), 18.3 bits, see alignment 3.8e-07 amino acids 202 to 246 (45 residues), 33.4 bits, see alignment 6.8e-12 PF01769: MgtE" amino acids 315 to 447 (133 residues), 128.9 bits, see alignment E=2e-41

Best Hits

KEGG orthology group: K06213, magnesium transporter (inferred from 100% identity to atu:Atu0999)

Predicted SEED Role

"Mg/Co/Ni transporter MgtE / CBS domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJL5 at UniProt or InterPro

Protein Sequence (457 amino acids)

>Atu0999 magnesium transport protein (Agrobacterium fabrum C58)
MNFHTLSQRASKAARLLRSGNAGSTTIAERVEHLNTLDTDAAVAALLAMPQAKAVAILDR
PELHDAAAIIAGIPLEQAARFVNLMSDDRVADVMAEMEEEPRAKLFARLDRTTALSIKHL
MGYPPRTAGSIMTTEFVSVPLDWTVEQTLSHIRVVERSRETVYAIYVLAEDGTLTTVVTL
RRLLTGEPSASILSVASKEGIAYASPLMSQEDVARLIRKHDLLALPVVDDHSHILGIVTV
DDVIDTMIADTTEDAHKFGGMEALGKPYMAMGFPDMIRKRAGWLAALFLGEMLTASAMQH
FEGELEKAVVLTLFIPLIMSSGGNSGSQATSLIIRALALGELKLSDWWRVLLREIPTGLT
LGCILGAIGFLRLTIWQQAGFYNYGEHWLLVGATVFAALVGIVTFGSLAGSMLPFLLQRL
RLDPASASAPFVATLVDVSGLVIYFSVALVILSGTLL