Protein Info for Atu0995 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details PF00805: Pentapeptide" amino acids 63 to 90 (28 residues), 21.2 bits, see alignment (E = 2.7e-08) amino acids 74 to 111 (38 residues), 35.6 bits, see alignment 8.4e-13 amino acids 88 to 124 (37 residues), 26.1 bits, see alignment 7.7e-10 amino acids 118 to 155 (38 residues), 27.5 bits, see alignment 2.8e-10 amino acids 153 to 185 (33 residues), 27.1 bits, see alignment 3.8e-10 PF13599: Pentapeptide_4" amino acids 74 to 146 (73 residues), 39.1 bits, see alignment E=1.1e-13 amino acids 133 to 185 (53 residues), 33.8 bits, see alignment E=4.9e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu0995)

Predicted SEED Role

"Mlr4046 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D066 at UniProt or InterPro

Protein Sequence (247 amino acids)

>Atu0995 hypothetical protein (Agrobacterium fabrum C58)
MSGFQRLNIVGKTRFGAAVAAGVVLAVVSLSGGPLGAASCRTDAMAGIDWRECNKRMLML
GSSNLDSAMLYGTDFTYTDLRGSSLKGANLEKAKLIRTALGEANLQGANLTKVEAYRSDF
SAADATNAKFVNAEMQRTKFEKTKLDGTDFTKAELGRADFEGASLNGSKFSLTNLSRARF
GGATLGGPVDFTSAFLLLTRIEGVDLSTATGLDQKQIDIACGDAKTKLPNGLTAPASWPC
PEDPDDD