Protein Info for Atu0994 in Agrobacterium fabrum C58

Annotation: electrotransfer ubiquinone oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 554 PF01946: Thi4" amino acids 11 to 57 (47 residues), 32.1 bits, see alignment 2.9e-11 PF05834: Lycopene_cycl" amino acids 16 to 51 (36 residues), 24.1 bits, see alignment 7.3e-09 PF00890: FAD_binding_2" amino acids 16 to 55 (40 residues), 28 bits, see alignment 5.5e-10 PF13450: NAD_binding_8" amino acids 19 to 60 (42 residues), 30.9 bits, see alignment 1.1e-10 PF21162: ETFQO_UQ-bd" amino acids 215 to 308 (94 residues), 143.1 bits, see alignment E=1.3e-45 PF05187: Fer4_ETF_QO" amino acids 451 to 551 (101 residues), 161.5 bits, see alignment E=2.3e-51

Best Hits

KEGG orthology group: K00311, electron-transferring-flavoprotein dehydrogenase [EC: 1.5.5.1] (inferred from 100% identity to atu:Atu0994)

Predicted SEED Role

"Electron transfer flavoprotein-ubiquinone oxidoreductase (EC 1.5.5.1)" in subsystem Acetyl-CoA fermentation to Butyrate or Anaerobic respiratory reductases (EC 1.5.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.5.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJL8 at UniProt or InterPro

Protein Sequence (554 amino acids)

>Atu0994 electrotransfer ubiquinone oxidoreductase (Agrobacterium fabrum C58)
MTEAMELPEREAMEFDVVIVGAGPAGLSAAIRLKQVEPELSVVVLEKGAEVGAHILSGAV
VDPIGIDRLLPGWRKEEGHPFKTEVKDDQFMFLGPAGSIRLPNFMMPPLMNNHGNYIVSL
GLVCRWLAEKAEALGVEIYPGFAATEVLYNDAGAVIGVATGDMGIEKNGEPGPAFTRGME
LHGKYVLVGEGVRGSLAKQLIAKYDLSKDREPQKFGIGIKELWQVKPEHHRQGLVQHSFG
WPLGFKTGGGSFLYHLEDNLVAVGFVVHLNYKNPYLYPFEEFQRFKTHPAIRDTFEGGKR
ISYGARAITEGGYQSVPKLTFPGGALIGCSAGFVNVPRIKGSHNAVLSGMLAAEKIAAAL
SAGRAHDEVVEIEAEWRDGDIGKDLKRVRNVKPLWSKFGTLVGVGLGGLDMWTNQLFGFS
VFGTLKHGKTDAQSLEPASKHKPIAYPKPDGVLTFDRLSSVFLSSTNHEEDQPVHLQVKD
MELQKRSEHDIYAGPSTRYCPAGVYEWVEKDGEEVYVINAQNCVHCKTCDIKDPNQNINW
VPPQGGEGPVYANM