Protein Info for Atu0977 in Agrobacterium fabrum C58

Annotation: serine protease DO-like protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 523 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details TIGR02037: peptidase Do" amino acids 57 to 516 (460 residues), 468.1 bits, see alignment E=1.4e-144 PF13365: Trypsin_2" amino acids 142 to 276 (135 residues), 126.3 bits, see alignment E=5.1e-40 PF00089: Trypsin" amino acids 143 to 303 (161 residues), 75.4 bits, see alignment E=1.8e-24 PF00595: PDZ" amino acids 311 to 389 (79 residues), 36.1 bits, see alignment E=2.1e-12 amino acids 435 to 493 (59 residues), 34.9 bits, see alignment 5.1e-12 PF13180: PDZ_2" amino acids 316 to 406 (91 residues), 61.6 bits, see alignment E=2.1e-20 amino acids 438 to 499 (62 residues), 30.6 bits, see alignment E=1e-10 PF17820: PDZ_6" amino acids 342 to 394 (53 residues), 36.5 bits, see alignment 1e-12

Best Hits

Swiss-Prot: 70% identical to DEGPL_RHIME: Probable periplasmic serine endoprotease DegP-like (degP1) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01362, [EC: 3.4.21.-] (inferred from 100% identity to atu:Atu0977)

Predicted SEED Role

"HtrA protease/chaperone protein"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJM8 at UniProt or InterPro

Protein Sequence (523 amino acids)

>Atu0977 serine protease DO-like protease (Agrobacterium fabrum C58)
MSHSQNGHSSLKTASLKTALKATTVGGLAALMLSTGIAAPILHSFAAPVEVTAPQVPSFA
NVVDAVSPAVVSVRVQSNVQPASDDSSNFSFNFGGRGLDQLPDDHPLKRFFKEFGGQNQD
RSDRGPNRHRDGKGPLRPVAQGSGFFISEDGYVVTNNHVVDDGSAYTVVMNDGTELEAKL
VGRDPRTDLALLKVDVNRKFTYVKFADDTKIRVGDWVVAVGNPFGLGGTVTSGIISARGR
DIGSGPYDDYLQIDAAVNRGNSGGPAFNLNGEVVGINTAIFSPSGGNVGIAFAIPSSVAK
DVIADLQKDGKVERGWLGVQIQPVSKDIAESLGLAEAKGALVVSPQSGSPGDKAGIKQGD
IITAVNGDPVKDARDLSRRIGGMAPNSKVEISLWRGGKSQSVTVTLGDLTSDEASKATPS
QNDDKGGSQSSSEKVLSSLGLTVSPSDDGNGLAITDVDPDSDAAARGLKTGEKITSVNNQ
QVASAADIEKILEQAKKDGRSKALFQIQTDDGSRFIALDIDQG