Protein Info for Atu0950 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 554 transmembrane" amino acids 9 to 32 (24 residues), see Phobius details amino acids 40 to 66 (27 residues), see Phobius details amino acids 78 to 98 (21 residues), see Phobius details amino acids 122 to 140 (19 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details PF15420: Abhydrolase_9_N" amino acids 29 to 236 (208 residues), 236 bits, see alignment E=4.7e-74 PF10081: Abhydrolase_9" amino acids 253 to 540 (288 residues), 385.9 bits, see alignment E=1e-119

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu0950)

Predicted SEED Role

"FIG01074849: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJP2 at UniProt or InterPro

Protein Sequence (554 amino acids)

>Atu0950 hypothetical protein (Agrobacterium fabrum C58)
MVKQWVERLFAGLSATGIVFGTVLFCASLTPSLLPRTWLMQGVLCGFSFAIGYMIGVALH
AIWAYLELPEPSRHNVRGVRFLIALAAAITAIAFLWQAKDWQNSIRVLMELDPLPSAHPT
KTGGLAVLVAALLIGAGRLFQLIRRFFAARSRHFLPRRLANVLGIAAAIVLSWMLLNGLI
FDIGLKFADSSLKQVDSLIEPDVPRPADPLKTGSSASLMTWESLGRRGREFVAEGPAGTQ
ISAFTHRPAKEPLRVYAGLNSAATPEERAALALQELKRVGGFERKVLLVVIPTGTGWIDP
EALDTVEYLHDGDIASVAVQYSYLSSWIALLTEPDYGVETARALFEAVYGYWTTLPKETR
PKLYLHGLSLGSLNSQKSSDLYDVLSDPFQGALWSGPPFSSPTWRMATNGRVEGTPEWLP
RFRDSSVIRFANQYTTAHMPGVDWGPMRIVYLQYASDPITFFEAASLYRRPQWMVHHGPD
VSTSFRWFPVVTLLQLGLDVAAATTAPMGYGHVYAPEHYIDAWMEVTQPQGWNAEDIQRL
KMLFKARRGSTDPA