Protein Info for Atu0947 in Agrobacterium fabrum C58

Annotation: transcriptional regulator, AsnC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 PF13412: HTH_24" amino acids 5 to 49 (45 residues), 57.8 bits, see alignment E=2.8e-19 PF13404: HTH_AsnC-type" amino acids 5 to 44 (40 residues), 58.8 bits, see alignment E=1.7e-19 PF13384: HTH_23" amino acids 6 to 48 (43 residues), 28.5 bits, see alignment E=4.5e-10 PF08279: HTH_11" amino acids 8 to 48 (41 residues), 32.3 bits, see alignment E=3.4e-11 PF09339: HTH_IclR" amino acids 9 to 48 (40 residues), 25.3 bits, see alignment E=4.7e-09 PF12802: MarR_2" amino acids 10 to 49 (40 residues), 28.6 bits, see alignment E=6e-10 PF08280: HTH_Mga" amino acids 10 to 43 (34 residues), 23.5 bits, see alignment 2.1e-08 PF01047: MarR" amino acids 10 to 49 (40 residues), 25.3 bits, see alignment E=5.3e-09 PF01037: AsnC_trans_reg" amino acids 69 to 139 (71 residues), 63.7 bits, see alignment E=5.4e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu0947)

Predicted SEED Role

"Transcriptional regulator, AsnC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D0A6 at UniProt or InterPro

Protein Sequence (143 amino acids)

>Atu0947 transcriptional regulator, AsnC family (Agrobacterium fabrum C58)
MAIADKDRALLALLSENARMPVAELARKLGLSRTTVQARIERLEADGVIAGYGLRLSESY
LSGLVRAHVLITIGPKALPAVTAALTAIKEVTTLHSVSGTFDLIAILAAPSILDLDRLID
RIGALDGVERTLSSIILSTRISR