Protein Info for Atu0933 in Agrobacterium fabrum C58

Annotation: beta-lactamase class D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00905: Transpeptidase" amino acids 48 to 266 (219 residues), 154.2 bits, see alignment E=2.3e-49

Best Hits

Swiss-Prot: 53% identical to BLO18_PSEAI: Beta-lactamase OXA-18 (bla) from Pseudomonas aeruginosa

KEGG orthology group: None (inferred from 100% identity to atu:Atu0933)

Predicted SEED Role

"Beta-lactamase class D" in subsystem Beta-lactamase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D0B8 at UniProt or InterPro

Protein Sequence (274 amino acids)

>Atu0933 beta-lactamase class D (Agrobacterium fabrum C58)
MHYRLPAIVLSCLALPGLLPLSAFAQQQPQAFECTLVTSIETGAIINQQGACDQRVAPAS
TFKVPLALIGFDAGILQDGKTPAWDWKPGTEARASDRKTVDPTIWEQDSVLWYSREITRR
LGPEKFAAYVKRLGYGNADVSGEPGKNNGLTHSWLGASLTISPVEQVGFLRRLLGGNLPF
SRDAQAKTRAIMPVFDAPESWAVHGKTGTGYMRDEKGNPDRNRPFGWFVGWAEREGQHIV
FARLRVSDKPSNEPLGPAVRDAFLRDIPRLAVHR