Protein Info for Atu0921 in Agrobacterium fabrum C58

Annotation: two component sensor kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 510 transmembrane" amino acids 37 to 56 (20 residues), see Phobius details amino acids 62 to 83 (22 residues), see Phobius details PF00512: HisKA" amino acids 237 to 306 (70 residues), 66.9 bits, see alignment E=1.4e-22 PF02518: HATPase_c" amino acids 353 to 463 (111 residues), 100.1 bits, see alignment E=1e-32

Best Hits

KEGG orthology group: K11357, two-component system, cell cycle sensor histidine kinase DivJ [EC: 2.7.13.3] (inferred from 100% identity to atu:Atu0921)

Predicted SEED Role

"Signal transduction histidine kinase"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D0C8 at UniProt or InterPro

Protein Sequence (510 amino acids)

>Atu0921 two component sensor kinase (Agrobacterium fabrum C58)
MREKAVALVDHAAGRWLARMEEDAERRAGTIARLRRLIAFSAVGLFIVPALFSLVFSPAI
ALPIGAAVVLALYLAAAALLIAFSRPAGGFSSPSAPSGDEDMIAAAQVPGLVLTLNENGL
VERVSGRDRDSFPADLKASKGEIFAEYVYVSDRIELMQAFDLLRQGEDKATAELRFETGA
KSRQTQFMHVRIEMTAIRGATGRLRRIVAQLSDVTEMERLRRDVARKAAEAESANDAKSR
FLAAVSHELRTPLNAVLGFSDILAGEYFGRLENDRQREYVGLIRQSGAHLLSVVNTMLDM
SKLEAGRYELLMESFPISETIASCEAMLGLQAKEKGLTLTSRIQRGIGEISADQRAIRQV
LINLAGNAIKFTDAGGVVSIDAAREGGMLKLTVSDTGIGIASDKIELLGQPFMQVQNEYT
RRYEGTGLGLSLVKGLVALHGGTFVITSKPAEGTVVTITLPADGSGMVGGGENAETECMV
EFPPRIRQLGDMAAKMKKDGDDGPAKAKIA