Protein Info for Atu0915 in Agrobacterium fabrum C58

Annotation: Na+/H+ antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 110 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 40 to 58 (19 residues), see Phobius details amino acids 69 to 91 (23 residues), see Phobius details PF03334: PhaG_MnhG_YufB" amino acids 13 to 92 (80 residues), 87.8 bits, see alignment E=2.4e-29 TIGR01300: monovalent cation/proton antiporter, MnhG/PhaG subunit" amino acids 15 to 106 (92 residues), 95.7 bits, see alignment E=7.9e-32

Best Hits

Swiss-Prot: 65% identical to Y998_RHIME: UPF0091 protein R00998 (R00998) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K05571, multicomponent Na+:H+ antiporter subunit G (inferred from 100% identity to atu:Atu0915)

Predicted SEED Role

"Na(+) H(+) antiporter subunit G" in subsystem Sodium Hydrogen Antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJQ8 at UniProt or InterPro

Protein Sequence (110 amino acids)

>Atu0915 Na+/H+ antiporter (Agrobacterium fabrum C58)
MMGWIVAILVAALTLSGALFSLIAAIGLNRLPDVYTRMHAASKAGTVGSGLLLLAVGIHS
MELSTLARALAGFLFFILTAPVSAHLLAMAAHKAGYPLADKSVVDDLKKM