Protein Info for Atu0914 in Agrobacterium fabrum C58

Annotation: Na+/H+ antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 128 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 39 to 58 (20 residues), see Phobius details amino acids 65 to 88 (24 residues), see Phobius details PF04066: MrpF_PhaF" amino acids 36 to 87 (52 residues), 65.2 bits, see alignment E=3e-22

Best Hits

KEGG orthology group: K05570, multicomponent Na+:H+ antiporter subunit F (inferred from 100% identity to atu:Atu0914)

Predicted SEED Role

"Na(+) H(+) antiporter subunit F" in subsystem Sodium Hydrogen Antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJQ9 at UniProt or InterPro

Protein Sequence (128 amino acids)

>Atu0914 Na+/H+ antiporter (Agrobacterium fabrum C58)
MTPELTVSFATILATVVLSAAFLLTVYRVVVGPTLPDRIVALDMLVGIAIGFIAVIAIRT
GFTLYVDIAIALGLVGFLATVAFARFVLSRGPDDRRRRATVLDGDRASEVIEKPMENDAR
GKKGRGRR