Protein Info for Atu0912 in Agrobacterium fabrum C58

Annotation: Na+/H+ antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 525 transmembrane" amino acids 24 to 44 (21 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details amino acids 92 to 118 (27 residues), see Phobius details amino acids 130 to 149 (20 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details amino acids 185 to 207 (23 residues), see Phobius details amino acids 227 to 252 (26 residues), see Phobius details amino acids 261 to 284 (24 residues), see Phobius details amino acids 294 to 315 (22 residues), see Phobius details amino acids 322 to 342 (21 residues), see Phobius details amino acids 349 to 368 (20 residues), see Phobius details amino acids 389 to 409 (21 residues), see Phobius details amino acids 427 to 453 (27 residues), see Phobius details amino acids 474 to 493 (20 residues), see Phobius details PF00361: Proton_antipo_M" amino acids 150 to 440 (291 residues), 170.3 bits, see alignment E=2.9e-54

Best Hits

KEGG orthology group: K05568, multicomponent Na+:H+ antiporter subunit D (inferred from 100% identity to atu:Atu0912)

Predicted SEED Role

"Na(+) H(+) antiporter subunit D" in subsystem Sodium Hydrogen Antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D0D7 at UniProt or InterPro

Protein Sequence (525 amino acids)

>Atu0912 Na+/H+ antiporter (Agrobacterium fabrum C58)
MASSTTSTVTDLSAALVMAPVPLADWLIILPIALCIGAGAVLMMMRHAIRHHAAVAIAAL
SLLVILNAALLWKVATQGPFTMVMGRWLPPFGIAFTADLTGALLSLAAAIVALAGAIHAG
ADIDASGRRYGFYPFLMLLMAGVTGAFLTGDLFNLYVWFEVLLISSFGLIVLGSTREQID
GALKYAILNLIGTTLFLITVGYLYAIFGTLNMADIALKATELRGTAPLMTLASLFALAFA
MKAAAFPVNFWLPASYHTPRIVVSALFGGLLTKVGIYSLLRVMVMLFPVEREELSIVIAI
SAALTMVLGAMGALAQNDIRRMLGYIVISGIGYMMAGIAIGTPSGVSGAIFYALHSMVLM
TALYLAAGHAARLGGGFSLTSLGDLYRQAPWFSALALALFFAGSGLPPFSGFWPKAVLVK
SAIDIGAWWLAAAILVSGFIATIAFGRVFLLCFWRPVTTSAGQPALQPAARPPAPSVAPL
VGLTLLVVFFGLFPESLLNLSQQAAAGLGNPQAYIQSVFPQGGKP