Protein Info for Atu0894 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 transmembrane" amino acids 61 to 81 (21 residues), see Phobius details amino acids 87 to 105 (19 residues), see Phobius details amino acids 111 to 133 (23 residues), see Phobius details amino acids 153 to 182 (30 residues), see Phobius details amino acids 233 to 252 (20 residues), see Phobius details amino acids 264 to 282 (19 residues), see Phobius details PF00528: BPD_transp_1" amino acids 125 to 294 (170 residues), 104.6 bits, see alignment E=2.7e-34

Best Hits

KEGG orthology group: K02001, glycine betaine/proline transport system permease protein (inferred from 100% identity to atu:Atu0894)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJS2 at UniProt or InterPro

Protein Sequence (302 amino acids)

>Atu0894 ABC transporter, membrane spanning protein (Agrobacterium fabrum C58)
MALCNYLPDLLCKFPAIDNSTMRVARKTIDDGFRDIVRNYGDAIDVIVHPLQLFLNASER
LFIETPWIITMLVILAIVHLAGRSFKITGGTAISLFMIGAVGLWRDAMTTLSIVTIATLI
AIVIGLPLGILMGRSERLQRLINPVLDVMQTLPSFVYLIPVVVIFGIGKVPGLIAVVIYA
IPPVIRLTSLGIRLVDREVLEAADAFGSSNGQKLFNVQLPLALPTIMTGINQTIMMALAM
VVVASMVGVGGLGKNVLQAINNQFFTVGFLNGFALVAIAIMFDRASQAFGKRLQKYREVS
HG