Protein Info for Atu0879 in Agrobacterium fabrum C58

Annotation: RhtB family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 transmembrane" amino acids 6 to 31 (26 residues), see Phobius details amino acids 42 to 66 (25 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 112 to 134 (23 residues), see Phobius details amino acids 146 to 170 (25 residues), see Phobius details amino acids 183 to 205 (23 residues), see Phobius details PF01810: LysE" amino acids 18 to 202 (185 residues), 87.2 bits, see alignment E=5.2e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu0879)

Predicted SEED Role

"cell processes; transport of small molecules; amino acids, amines, peptides"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D0G4 at UniProt or InterPro

Protein Sequence (214 amino acids)

>Atu0879 RhtB family transporter (Agrobacterium fabrum C58)
MNYAENLWLFFLLLFGIIILPGMDMMFVLASALTGGRKTGLSAASGMSAGGMVHSLYGAA
GVGLLATWLPSLFLPLLVGGAACMVWIGFGLMRSAITVNGDEAQASTSARKAFWRAVITC
LSNPKAYLFMMAVYPQFIKPGFGPIWMQGLVMGAMVAVTQFAVYGTVALTADRSRAWLIS
SPAATIFIGRAAGFLLIAAALLTFWEAFSWSMGE