Protein Info for Atu0876 in Agrobacterium fabrum C58

Annotation: superoxide dismutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00081: Sod_Fe_N
  • amino acids 3 to 84 (82 residues), 95.6 bits, E=2e-31
• PF02777: Sod_Fe_C
  • amino acids 95 to 193 (99 residues), 115.9 bits, E=7.8e-38

Best Hits

Swiss-Prot: 88% identical to SODF_RHIME: Superoxide dismutase [Mn] (sodB) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K04564, superoxide dismutase, Fe-Mn family [EC: 1.15.1.1] (inferred from 100% identity to atu:Atu0876)

MetaCyc: 50% identical to superoxide dismutase (Fe) (Burkholderia sp. AK-5)
Superoxide dismutase. [EC: 1.15.1.1]

Predicted SEED Role

"Manganese superoxide dismutase (EC 1.15.1.1)" in subsystem Nitric oxide synthase or Oxidative stress (EC 1.15.1.1)

MetaCyc Pathways

• superoxide radicals degradation (2/2 steps found)
• reactive oxygen species degradation (3/4 steps found)
• ethene biosynthesis III (microbes) (5/7 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.15.1.1

Use Curated BLAST to search for 1.15.1.1

Sequence Analysis Tools

See A9CJS9 at UniProt or InterPro

Protein Sequence (200 amino acids)

>Atu0876 superoxide dismutase (Agrobacterium fabrum C58)
MAFELPELPYDYDALAPYMSRETLEFHHDKHHKAYVDNGNKLAAEAGLSDLSLEEVVKKS
FGTNAGLFNNAAQHYNHVHFWKWMKKDGGGNKLPGKLEQAFASDLGGYDKFKADFIAAGT
TQFGSGWAWLSVKNGKLEISKTPNGENPLVHGADPILGVDVWEHSYYIDYRNLRPKYLEA
FVDNLINWDYVLERYEAAAK