Protein Info for Atu0866 in Agrobacterium fabrum C58

Annotation: RhtB family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 36 to 60 (25 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 107 to 129 (23 residues), see Phobius details amino acids 148 to 169 (22 residues), see Phobius details amino acids 181 to 200 (20 residues), see Phobius details PF01810: LysE" amino acids 11 to 200 (190 residues), 126 bits, see alignment E=6.6e-41

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu0866)

Predicted SEED Role

"RhtB family transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D0H6 at UniProt or InterPro

Protein Sequence (203 amino acids)

>Atu0866 RhtB family transporter (Agrobacterium fabrum C58)
MTPEFLITSFIVAASPGTGVVYTLAAGLSQGAKASIIAAFGCTLGIVPHLLAAITGLAAI
LHTSALAFGIVKYLGVAYLLYMAWNTLRENGALKIDETRQPQKPARVIGEAILINLLNPK
LSIFFFAFLPQFIAPGELSPTWRMIDLGLIFMALTFLVFALYGCFAASVRRQVVSRPAVL
AWLRRSFAAAFVALGAKLAFTER