Protein Info for Atu0857 in Agrobacterium fabrum C58

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 PF00106: adh_short" amino acids 5 to 194 (190 residues), 186 bits, see alignment E=1.1e-58 PF08659: KR" amino acids 7 to 184 (178 residues), 70.1 bits, see alignment E=4.6e-23 PF01370: Epimerase" amino acids 7 to 187 (181 residues), 22.9 bits, see alignment E=1e-08 PF13561: adh_short_C2" amino acids 11 to 200 (190 residues), 129.7 bits, see alignment E=2.7e-41

Best Hits

Swiss-Prot: 46% identical to Y432_LISMO: Uncharacterized oxidoreductase Lmo0432 (lmo0432) from Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)

KEGG orthology group: None (inferred from 100% identity to atu:Atu0857)

MetaCyc: 45% identical to clavulanate dehydrogenase subunit (Streptomyces clavuligerus)
RXN-8893

Predicted SEED Role

"Short chain dehydrogenase"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D0I4 at UniProt or InterPro

Protein Sequence (240 amino acids)

>Atu0857 oxidoreductase (Agrobacterium fabrum C58)
MALNKVVLITGASSGIGEGIARELAGAGAKLVLGARRMDRLQSLAEELRRKGAEVVIHTL
DVTDRQSVEAFAEAGRKALGQIDVIVNNAGIMPLSLMSSLKVDEWDRMIEVNIKGVLYGV
AAVLPEMTARASGHIINIASIGALAVSPTAAVYCATKFAVRAISDGLRQENRDLRVTCIH
PGVVESELAHTITDPAAAELMQSYRAIALKPDAIGRAVRYAIEQPDDVDVNEIVIRPTAA