Protein Info for Atu0836 in Agrobacterium fabrum C58

Annotation: Glutathione-S-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 PF02798: GST_N" amino acids 2 to 85 (84 residues), 42.7 bits, see alignment E=1.7e-14 PF13417: GST_N_3" amino acids 5 to 90 (86 residues), 40.1 bits, see alignment E=1.1e-13 PF13409: GST_N_2" amino acids 12 to 85 (74 residues), 49.1 bits, see alignment E=2e-16 PF00043: GST_C" amino acids 132 to 204 (73 residues), 52.4 bits, see alignment E=1.5e-17 PF13410: GST_C_2" amino acids 137 to 200 (64 residues), 39.5 bits, see alignment E=1.5e-13 PF14497: GST_C_3" amino acids 140 to 208 (69 residues), 35.4 bits, see alignment E=3.1e-12

Best Hits

KEGG orthology group: K00799, glutathione S-transferase [EC: 2.5.1.18] (inferred from 100% identity to atu:Atu0836)

Predicted SEED Role

"Maleylacetoacetate isomerase (EC 5.2.1.2) / Glutathione S-transferase" in subsystem Gentisare degradation or Homogentisate pathway of aromatic compound degradation or Salicylate and gentisate catabolism (EC 5.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18 or 5.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJU4 at UniProt or InterPro

Protein Sequence (219 amino acids)

>Atu0836 Glutathione-S-transferase (Agrobacterium fabrum C58)
MLTIYGVYRSRATRTLWLAAELGIEFKHVPVIQARRLADPLATDAPLNTLSPAFLAVNPM
GTIPCIEDDGMVLYESMAINLYLARKYGGPLAPVDLKEDAAMLQWSFFAATEIETNSLKI
SSAIAEGLAESDAGKAVIDVAARLLKRPLRVLEQHLATHDYLVGDRFTVADLNVAEIVRY
AQGHQPLFDAHPALKAWLARCQARTAFKSMWDSRTAEAA