Protein Info for Atu0818 in Agrobacterium fabrum C58

Annotation: phosphoadenosine phosphosulfate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 PF01507: PAPS_reduct" amino acids 38 to 212 (175 residues), 133.1 bits, see alignment E=5.7e-43 TIGR02055: adenylylsulfate reductase, thioredoxin dependent" amino acids 43 to 236 (194 residues), 271.3 bits, see alignment E=2.3e-85

Best Hits

Swiss-Prot: 100% identical to CYSH_AGRFC: Phosphoadenosine phosphosulfate reductase (cysH) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00390, phosphoadenosine phosphosulfate reductase [EC: 1.8.4.8] (inferred from 100% identity to atu:Atu0818)

MetaCyc: 76% identical to phosphoadenylyl-sulfate reductase (thioredoxin) (Sinorhizobium meliloti)
Adenylyl-sulfate reductase (thioredoxin). [EC: 1.8.4.10]

Predicted SEED Role

"Phosphoadenylyl-sulfate reductase [thioredoxin] (EC 1.8.4.8) / Adenylyl-sulfate reductase [thioredoxin] (EC 1.8.4.10)" in subsystem Cysteine Biosynthesis (EC 1.8.4.10, EC 1.8.4.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.10 or 1.8.4.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UH67 at UniProt or InterPro

Protein Sequence (253 amino acids)

>Atu0818 phosphoadenosine phosphosulfate reductase (Agrobacterium fabrum C58)
MTINSTNASADTASLDATLAGLDLAGRLSFVAGLGGRAVFTTSLGIEDQVITAAIGTHRL
PIDVVTLETGRLFKETVDLIDETEERFGIEIRRFRPEQDDIDAYAAKYGLNGFYESVEAR
HACCHVRKLIPLGKALEGAAFWITGLRRGQSGNRAATPFAEFDAERNLIKINALADWDIE
QIRAYVAEENIPVNPLHQRGYPSIGCEPCTRAIKPGEPERAGRWWWENDEKRECGLHVAG
AEQTPPVSAIPQR