Protein Info for Atu0800 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details PF13462: Thioredoxin_4" amino acids 61 to 224 (164 residues), 169.8 bits, see alignment E=9.1e-54 PF13098: Thioredoxin_2" amino acids 71 to 225 (155 residues), 29 bits, see alignment E=1.8e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu0800)

Predicted SEED Role

"Periplasmic thiol:disulfide interchange protein DsbA" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJV6 at UniProt or InterPro

Protein Sequence (226 amino acids)

>Atu0800 hypothetical protein (Agrobacterium fabrum C58)
MHFPELTISRRSLLGGVALAAIATALPFAFTPGIAEAQELPESTGDVDMAAVMKPGPLPE
AALGDANAPVKIVEYMSMTCPHCANFHNKTFEEIKKKYIDTGKVYFVLREFPFDPRAAAA
FMLARCAPEGQYFPFVSMLFKQQQSWAVAQDARAALLQMSKMAGFSQESFEACLTNQKLL
DDVNATMQRGATEFGVNSTPTFIINGKKYAGDMSVETMSAVIDKLL