Protein Info for Atu0797 in Agrobacterium fabrum C58

Annotation: hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 PF00702: Hydrolase" amino acids 4 to 180 (177 residues), 37.9 bits, see alignment E=2.5e-13 PF13419: HAD_2" amino acids 73 to 184 (112 residues), 29.6 bits, see alignment E=6.8e-11 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 121 to 185 (65 residues), 54.6 bits, see alignment E=7.2e-19

Best Hits

KEGG orthology group: K01560, 2-haloacid dehalogenase [EC: 3.8.1.2] (inferred from 100% identity to atu:Atu0797)

Predicted SEED Role

"Hydrolase (EC 3.8.1.2)" (EC 3.8.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.8.1.2

Use Curated BLAST to search for 3.8.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJV8 at UniProt or InterPro

Protein Sequence (203 amino acids)

>Atu0797 hydrolase (Agrobacterium fabrum C58)
MTKIDHIVFDIGKVLIHYDPHIPYSRLIPDADERQWFFENVCTHDWNLEQDRGRRWEDAE
ALLLERFPEREEHIRAFRKFWHEMVSHSYDDSVAIMVALIDSGHDVTMLTNFASDTFREA
QKMFPFLTLPRGVTVSGDVKLLKPDVAIYHLHAKEFGLNPATSLFIDDTLANVEGAKAAG
WQAVHFTGAEKLKQDLRAYGVEV