Protein Info for Atu0787 in Agrobacterium fabrum C58

Annotation: threonine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 523 PF14821: Thr_synth_N" amino acids 60 to 138 (79 residues), 94.4 bits, see alignment E=5.7e-31 TIGR00260: threonine synthase" amino acids 128 to 478 (351 residues), 283.9 bits, see alignment E=8.9e-89 PF00291: PALP" amino acids 157 to 387 (231 residues), 54.1 bits, see alignment E=2.3e-18 PF24857: THR4_C" amino acids 445 to 515 (71 residues), 81.5 bits, see alignment E=6.2e-27

Best Hits

KEGG orthology group: K01733, threonine synthase [EC: 4.2.3.1] (inferred from 100% identity to atu:Atu0787)

Predicted SEED Role

"Threonine synthase (EC 4.2.3.1)" in subsystem Threonine and Homoserine Biosynthesis (EC 4.2.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJW5 at UniProt or InterPro

Protein Sequence (523 amino acids)

>Atu0787 threonine synthase (Agrobacterium fabrum C58)
MAMVYSSDAGKNRLACSVLLEFSKKPFITSPIASFRRDAADKEPVTARTDRLRTRDYLVK
YVSTRGAAPSLGFCDALLAGLGRDGGLYVPREWPSMSKKEIRNLRGKSYQDVAFEVLYRF
TGGEIPADKFKAMIDDAYSTFRHPAVVPLTQTGPNTFVLELFHGTTLAFKDVAMQLLARL
MDYTLTERGERAAIVGATSGDTGGAAIDAFAGRERTDIFILFPNGKVSPVQQRQMTTSTA
SNVYALAINGNFDDCQTLVKEMFNDVKFRDGVKLSGVNSINWARIMAQVVYYFTASLSLG
GPDRKISFTVPTGNFGDIFAGYVAKKMGLPIDKLVIATNDNDILARTLKTGRYEMRGVKP
TTSPSMDIQISSNFERLLFEAYDRDSAAVKASMDGLKQSGAFEIPPKALKFIKKDFRAGR
ATEKQVAATIRDTLEKTGYLIDPHTATGVFVAEKHEKAGSPMVVLSTAHPAKFPAAVKSA
CAIEPALPVWLADIMNREERFDILDAELKAVETFIGQHARAGK