Protein Info for Atu0784 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 971 signal peptide" amino acids 14 to 14 (1 residues), see Phobius details amino acids 35 to 36 (2 residues), see Phobius details transmembrane" amino acids 15 to 34 (20 residues), see Phobius details amino acids 195 to 217 (23 residues), see Phobius details amino acids 223 to 245 (23 residues), see Phobius details amino acids 257 to 280 (24 residues), see Phobius details amino acids 286 to 307 (22 residues), see Phobius details amino acids 314 to 336 (23 residues), see Phobius details amino acids 342 to 363 (22 residues), see Phobius details amino acids 375 to 397 (23 residues), see Phobius details PF08447: PAS_3" amino acids 436 to 521 (86 residues), 60.4 bits, see alignment E=3.4e-20 TIGR00229: PAS domain S-box protein" amino acids 457 to 534 (78 residues), 32.8 bits, see alignment E=6.6e-12 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 537 to 698 (162 residues), 108.2 bits, see alignment E=3.6e-35 PF00990: GGDEF" amino acids 539 to 696 (158 residues), 128.2 bits, see alignment E=5.3e-41 PF00563: EAL" amino acids 716 to 950 (235 residues), 234.2 bits, see alignment E=2.9e-73

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu0784)

Predicted SEED Role

"Sensory box/GGDEF domain/EAL domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJW7 at UniProt or InterPro

Protein Sequence (971 amino acids)

>Atu0784 hypothetical protein (Agrobacterium fabrum C58)
MTYNHTAPCLSKRLAAIALAVPFFLLFVLFASHSYAFEPVKISRDDTALDLTATTDIYAN
QGEAFQVSTAPGPDGIRRRIEVRASSEDHQGDWAVFALANVSEEQLERVIVAPHFRLVNS
KLFWPDLGSQRIIAITPSEGFALDRQPSPDADVFRITLNPGSVITFVAELSTPQLPQIYL
WEPEAYKDTINAFTLYRGIVLGIAGLLAVLLTILFVVKGTSVLPASAALAWAVLAYICVD
FGFLEKLITVTSSDQRIWRAGAEVALASSFVVFLFTYLNLNRWHAHLGYATFAWVVGLAL
LFGVAIYDPSVASGIARVSFALTATAGIALIIYLGFNRYDRAILLVPSWALILVWLFGSW
LTVTGQLDNDIVQPALGGGLVLIVLLIGFTVIQHAFAGSAYQQGLFSDLERQSLALTGSG
DTVWDWDVTRDRIVTTPDISNRLGLEPGTMHGAARNWLPRLHPDDRDRFKATLDVLLDHR
KGRLNHEFRIRAEDGHFHWLQIRARPVLGSNGEIIRCVGTITDITEQKNSVERLLQDAMN
DNLTGLPNRQVFLDRLQSILNLSPDSEGVRPTVMAIDIDRYKLVNDTLGIAAGDNILIAL
TRRLRRLLKPQDTLARLGGDEFGLILTSERDPQRVADFADAVNKAIMVPINFANREIILT
ASIGLVSWIDQQESAAGLLSDAELAMYRAKRAGGNRVEPFRPAFRTSGTDRLQMESDLRR
AIERKELSLAYQPIVKLDDGALAGFEALMRWEHPKRGNIPPSEFIPIAEASGLIEPLGMF
ALERAATDLMDWQHAIDKMPIFISVNISSAQLLNNELYNDVRGMLTRTRCNPQQLKLELT
ESVVMENPEQARLVLSKLKETGLSLAMDDFGTGYSSLAYLTRFPFDTIKLDKALVANTSD
KRNVLLRSVIAMARALDMQVVAEGIETPEDAAELARMNCHFGQSFMFGTPVSGDAALKLL
RERFQPTKRAS