Protein Info for Atu0779 in Agrobacterium fabrum C58

Annotation: peroxiredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 PF00578: AhpC-TSA" amino acids 5 to 116 (112 residues), 33 bits, see alignment E=5.4e-12 PF08534: Redoxin" amino acids 5 to 157 (153 residues), 121 bits, see alignment E=3.7e-39

Best Hits

Swiss-Prot: 50% identical to PRX2C_ORYSJ: Peroxiredoxin-2C (PRXIIC) from Oryza sativa subsp. japonica

KEGG orthology group: None (inferred from 100% identity to atu:Atu0779)

MetaCyc: 47% identical to glutaredoxin-dependent peroxiredoxin (Arabidopsis thaliana col)
RXN-20687 [EC: 1.11.1.25]

Predicted SEED Role

"Peroxiredoxin"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.11.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJW9 at UniProt or InterPro

Protein Sequence (161 amino acids)

>Atu0779 peroxiredoxin (Agrobacterium fabrum C58)
MTIKIGEKLPSATFKEKTADGPVETTTDALFGGKKVVLFAVPGAFTPTCSLNHLPGYLEN
RDAILAKGVDDIAVVSVNDWHVMGAWAQSSGGQGKIHFLADWDASFTKALGLDADLSGGG
LGVRSKRYSMLVEDGVVKSLNVEENPGQATVSAAAAMIEQL