Protein Info for Atu0771 in Agrobacterium fabrum C58

Annotation: cytochrome c oxidase subunit III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00510: COX3
  • amino acids 9 to 283 (275 residues), 303.1 bits, E=1.1e-94

Best Hits

KEGG orthology group: K02276, cytochrome c oxidase subunit III [EC: 1.9.3.1] (inferred from 100% identity to atu:Atu0771)

Predicted SEED Role

"Cytochrome c oxidase polypeptide III (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

• aerobic respiration I (cytochrome c) (3/4 steps found)
• arsenite to oxygen electron transfer (1/2 steps found)
• aerobic respiration II (cytochrome c) (yeast) (2/4 steps found)
• arsenite to oxygen electron transfer (via azurin) (1/3 steps found)
• Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

See A9CJX2 at UniProt or InterPro

Protein Sequence (291 amino acids)

>Atu0771 cytochrome c oxidase subunit III (Agrobacterium fabrum C58)
MADTHQKNHDYHIIDPSPWPLLASIGAFIMTFGGVCYMRYLSGGSFKLFGAELANPWLFY
IGLVIVLYVMYAWWADTIKEANEGSHTRVVSLHLRYGMIMFIASEVMFFVAWFWAYFDAS
LFPHEAIQASRLEYTGGQWPPKGIEVIDPWHLPLYNTVILLLSGTCVTWAHHALLHNDRK
GLISGLALTVALGVLFSTVQVYEYIHAPFDFKNSIYGATFFMATGFHGFHVFVGTVFLLV
CLFRAIAGGFTPKQHFGFEAAAWYWHFVDVVWLFLFFAIYIWGGWGAPLHG