Protein Info for Atu0770 in Agrobacterium fabrum C58

Annotation: cytochrome C oxidase assembly protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to COXZ_AGRFC: Cytochrome c oxidase assembly protein CtaG (ctaG) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02258, cytochrome c oxidase subunit XI assembly protein (inferred from 100% identity to atu:Atu0770)

Predicted SEED Role

"Cytochrome oxidase biogenesis protein Cox11-CtaG, copper delivery to Cox1" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UHB2 at UniProt or InterPro

Protein Sequence (205 amino acids)

>Atu0770 cytochrome C oxidase assembly protein (Agrobacterium fabrum C58)
MANMEAETARAGSQRVSNRSILVLCLVFFCAMIGMAYAAVPLYSLFCRVTGYNGTTQRVE
QYSDVILDKTINVTFDANTSNGLNWDFRPVDKMVKPKIGETIKVTFKATNRSPVATTGTA
VFNVTPMEAGAYFNKVECFCFTETTLQPGETLEMPVVFFVDPDIATARETKSVHTLTLSY
TFYPAKTEKPVASLPVKTESGDSKL