Protein Info for Atu0769 in Agrobacterium fabrum C58

Annotation: protoheme IX farnesyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 33 to 49 (17 residues), see Phobius details amino acids 55 to 78 (24 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details amino acids 126 to 146 (21 residues), see Phobius details amino acids 154 to 176 (23 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 227 to 243 (17 residues), see Phobius details amino acids 249 to 267 (19 residues), see Phobius details amino acids 287 to 307 (21 residues), see Phobius details TIGR01473: protoheme IX farnesyltransferase" amino acids 23 to 303 (281 residues), 318.9 bits, see alignment E=1.9e-99 PF01040: UbiA" amino acids 37 to 288 (252 residues), 212.8 bits, see alignment E=2.5e-67

Best Hits

Swiss-Prot: 100% identical to COXX_AGRFC: Protoheme IX farnesyltransferase (ctaB) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02301, protoheme IX farnesyltransferase [EC: 2.5.1.-] (inferred from 100% identity to atu:Atu0769)

Predicted SEED Role

"Cytochrome c oxidase polypeptide I (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1, 2.5.1.-

Use Curated BLAST to search for 1.9.3.1 or 2.5.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJX3 at UniProt or InterPro

Protein Sequence (317 amino acids)

>Atu0769 protoheme IX farnesyltransferase (Agrobacterium fabrum C58)
MTVIDDRDMMGAESSELSEAGARDYFELLKPRVMSLVVFTAFAGLVLAPGEINPILGLIA
ILCIAVGAGASGALNMWYDADIDAVMTRTAKRPIPSGRIAPREALAFGLTLSAFSVVILG
LAVNWFSAGLLAFTIFFYAVVYTMWLKRSTPQNIVIGGAAGAFPPMLGWACVTGGVSLDS
VILFLIIFLWTPAHFWALALFKMRDYGAVGIPMMPNVAGERSTKNQMIVYAVLTAAAAVA
PFFTGLASAGYGIFAAVLSAIFVYCSFDVRRMPEGDEKMLPAKKMFAYSVLYLFAIFSGL
LADHFAPALKAVISGVL