Protein Info for Atu0767 in Agrobacterium fabrum C58

Annotation: cytochrome c oxidase subunit II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 signal peptide" amino acids 1 to 13 (13 residues), see Phobius details transmembrane" amino acids 39 to 60 (22 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details PF02790: COX2_TM" amino acids 15 to 101 (87 residues), 88.7 bits, see alignment E=2.2e-29 TIGR02866: cytochrome c oxidase, subunit II" amino acids 26 to 254 (229 residues), 184.2 bits, see alignment E=1e-58 PF00116: COX2" amino acids 114 to 245 (132 residues), 144.4 bits, see alignment E=1.6e-46

Best Hits

KEGG orthology group: K02275, cytochrome c oxidase subunit II [EC: 1.9.3.1] (inferred from 100% identity to atu:Atu0767)

Predicted SEED Role

"Cytochrome c oxidase polypeptide II (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D0Q4 at UniProt or InterPro

Protein Sequence (287 amino acids)

>Atu0767 cytochrome c oxidase subunit II (Agrobacterium fabrum C58)
MTCLLTAVGAHADQPVHWQMGMQEAATPIMHEIRWFEQYTLWFIVPVTLFVLALLIIVAV
KFHAAKNPVASKTSHNTAIEVVWTLAPVLILLFLAFPSFNLLNAQLTQPENPDLTLKATA
TQWLWSYEYKAAEGAEPLSFDSYLLKDQDRAAAGKEDKARYPRLLAVDNEMVVPVGKTVR
LLVTAAPTDVIHAFAMPAFGVKIDAVPGRLNETWFKPEKEGLYYGQCSELCGKDHAFMPI
AIRVVSEQQYNTWHAAAASDLNGANRALMASVDGAPRTVDVAANETN