Protein Info for Atu0757 in Agrobacterium fabrum C58

Annotation: enoyl-(acyl-carrier-protein) reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 PF13561: adh_short_C2" amino acids 17 to 255 (239 residues), 320.3 bits, see alignment E=1.2e-99 PF00106: adh_short" amino acids 22 to 200 (179 residues), 78.7 bits, see alignment E=6.2e-26 PF23441: SDR" amino acids 66 to 253 (188 residues), 37.2 bits, see alignment E=3.4e-13

Best Hits

Swiss-Prot: 89% identical to FABI1_RHIME: Enoyl-[acyl-carrier-protein] reductase [NADH] 1 (fabI1) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00208, enoyl-[acyl-carrier protein] reductase I [EC: 1.3.1.9] (inferred from 100% identity to atu:Atu0757)

MetaCyc: 64% identical to enoyl-(acyl-carrier-protein) reductase [NADH] (Agrobacterium fabrum C58)
Enoyl-[acyl-carrier-protein] reductase (NADH). [EC: 1.3.1.9]

Predicted SEED Role

"Enoyl-[acyl-carrier-protein] reductase [NADH] (EC 1.3.1.9)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.3.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.1.9

Use Curated BLAST to search for 1.3.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJX9 at UniProt or InterPro

Protein Sequence (272 amino acids)

>Atu0757 enoyl-(acyl-carrier-protein) reductase (Agrobacterium fabrum C58)
MAQASGLMAGKRGLIMGVANNRSIAWGIAKACADAGAELALTWQGDALKKRVEPLAQELG
AFMAGHCDVTDLETIDSVFASLEQHWGKIDFVVHAIAFSDKDELTGRYLDTSRDNFNRTM
DISVFSLAAVAKRAEPIMNDGGSIITLTYYGAEKVMPNYNVMGVAKAALEASVRYLAVDL
GNRGIRVNAVSAGPIKTLAASGIGDFRYILKWNEYNAPLKRTVTIEEVGKSALYLLSDLS
TAVTGEIHHVDSGYHTIGMKAVDAPDISVVKD