Protein Info for Atu0751 in Agrobacterium fabrum C58

Annotation: ABC transporter, nucleotide binding/ATPase protein (cobalt)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 PF00005: ABC_tran" amino acids 23 to 162 (140 residues), 94.4 bits, see alignment E=9.4e-31 PF13304: AAA_21" amino acids 117 to 193 (77 residues), 33.5 bits, see alignment E=4.8e-12

Best Hits

Swiss-Prot: 68% identical to BIOM_RHIEC: Biotin transport ATP-binding protein BioM (bioM) from Rhizobium etli (strain CFN 42 / ATCC 51251)

KEGG orthology group: K02006, cobalt/nickel transport system ATP-binding protein (inferred from 100% identity to atu:Atu0751)

Predicted SEED Role

"ATPase component BioM of energizing module of biotin ECF transporter" in subsystem Biotin biosynthesis or ECF class transporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D0R9 at UniProt or InterPro

Protein Sequence (226 amino acids)

>Atu0751 ABC transporter, nucleotide binding/ATPase protein (cobalt) (Agrobacterium fabrum C58)
MEIRFDAAGVAFEGRQALQPLSLTLIERRIGVIGLNGSGKTTFARLINGLNKPSQGKVLV
NGLDTVADAKAILQMVGFIFQNPQNQIILPIVRDDVAFGLKRLGLGKTEIENRVKAVLAR
LAVSHLEERRAHELSGGELQLAALAALLVTEPQILILDEPTNQLDLKNRAIVEKTMAALS
QSLIVITHDLPLLQGFDRVLVFHGGALVADAGPEEAVARYLEVAAQ