Protein Info for Atu0749 in Agrobacterium fabrum C58

Annotation: biotin synthesis BioY protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 29 to 48 (20 residues), see Phobius details amino acids 55 to 73 (19 residues), see Phobius details amino acids 79 to 102 (24 residues), see Phobius details amino acids 114 to 146 (33 residues), see Phobius details amino acids 152 to 160 (9 residues), see Phobius details amino acids 163 to 183 (21 residues), see Phobius details PF02632: BioY" amino acids 29 to 176 (148 residues), 120.3 bits, see alignment E=3.2e-39

Best Hits

Swiss-Prot: 74% identical to BIOY_RHIEC: Biotin transporter BioY (bioY) from Rhizobium etli (strain CFN 42 / ATCC 51251)

KEGG orthology group: K03523, putative biotin biosynthesis protein BioY (inferred from 100% identity to atu:Atu0749)

Predicted SEED Role

"Substrate-specific component BioY of biotin ECF transporter" in subsystem Biotin biosynthesis or ECF class transporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJY4 at UniProt or InterPro

Protein Sequence (187 amino acids)

>Atu0749 biotin synthesis BioY protein (Agrobacterium fabrum C58)
MTTRDLVLISLFSAIIIALGLLPPITLGFIPVPITAQSLGVMLAGVVLGAKRGTLAVLLT
ILIAGIGLPVLSGGRGGLSIFTTPTTGFLIGWIAAVFVTGFLSEKFVHSGQSALAQGVGF
FVASLIGGVVVLYAFGITYLALVVGLGFEKAFIGSLLFIPGDALKAVLAALAGRAVMAGY
PLLPQRA