Protein Info for Atu0745 in Agrobacterium fabrum C58

Annotation: 1-deoxy-D-xylulose-5-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 639 PF13292: DXP_synthase_N" amino acids 10 to 283 (274 residues), 389.3 bits, see alignment E=2.8e-120 TIGR00204: 1-deoxy-D-xylulose-5-phosphate synthase" amino acids 12 to 628 (617 residues), 800.7 bits, see alignment E=4.7e-245 PF00456: Transketolase_N" amino acids 33 to 188 (156 residues), 22.3 bits, see alignment E=1.8e-08 PF00676: E1_dh" amino acids 122 to 201 (80 residues), 27.2 bits, see alignment E=5.7e-10 PF02775: TPP_enzyme_C" amino acids 123 to 182 (60 residues), 23.4 bits, see alignment 1.4e-08 PF02779: Transket_pyr" amino acids 320 to 481 (162 residues), 148.1 bits, see alignment E=6.5e-47 PF02780: Transketolase_C" amino acids 497 to 620 (124 residues), 100.9 bits, see alignment E=1.5e-32

Best Hits

Swiss-Prot: 100% identical to DXS_AGRFC: 1-deoxy-D-xylulose-5-phosphate synthase (dxs) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01662, 1-deoxy-D-xylulose-5-phosphate synthase [EC: 2.2.1.7] (inferred from 100% identity to atu:Atu0745)

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate synthase (EC 2.2.1.7)" in subsystem Isoprenoid Biosynthesis or Pyridoxin (Vitamin B6) Biosynthesis or Thiamin biosynthesis (EC 2.2.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.2.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UHD7 at UniProt or InterPro

Protein Sequence (639 amino acids)

>Atu0745 1-deoxy-D-xylulose-5-phosphate synthase (Agrobacterium fabrum C58)
MTGMPQTPLLDRVNFPSDLKEIDDRDLPELARELRDEMIDAVSKTGGHLGAGLGVVELTI
AIHKVFNTPEDRLIFDVGHQCYPHKILTGRRDRIRTLRQEDGLSGFTRRAESEYDDFGAG
HSSTSISAGLGMAVAAGLDGSDRKVIAVIGDGSMSAGMAFEALNNAGALDARLIVILNDN
DMSIAPPTGAMSAYLARLASGRTYMGFRDFGKKLTAYLGKTIDRAITRAVTHARGYVTGG
TLFEELGFYHIGPIDGHSFDHLLPVLRNVRDNQKGPVLIHVVTQKGKGYAPAEAAADKYH
GVNKFDVITGAQAKAKPNAPSYTSVFAEALIQEATLDEKIIGVTAAMPNGTGLDKMAELF
PSRTFDVGIAEQHAVTFAAGLAADGYKPFCALYSTFLQRGYDQLVHDVAIQSLPVRFPID
RAGFVGADGPTHAGSFDTTFLATLPGMVVMAAADEAELKHMVRTAAAYDEGPISFRYPRG
EGVGVEMPARGEILQIGKGRIIKEGTKVALLSFGTRLAECLAAAEDLDAAGLSTTVADAR
FAKPLDLDLIRQLAAHHEVLVTIEEGSVGGFGAHVLHFMASAGLLDHGPKVRTLTLPDQW
VEQAKPETMYANAGLDRAGIVSTVFNALGQRQAGVGFAG