Protein Info for Atu0732 in Agrobacterium fabrum C58

Annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 594 PF02771: Acyl-CoA_dh_N" amino acids 38 to 155 (118 residues), 54.6 bits, see alignment E=4e-18 PF02770: Acyl-CoA_dh_M" amino acids 160 to 268 (109 residues), 49.9 bits, see alignment E=8.7e-17 PF00441: Acyl-CoA_dh_1" amino acids 287 to 451 (165 residues), 82.8 bits, see alignment E=8.5e-27 PF22924: ACOX_C_alpha1" amino acids 296 to 448 (153 residues), 31.1 bits, see alignment E=6e-11 PF08028: Acyl-CoA_dh_2" amino acids 304 to 446 (143 residues), 29.1 bits, see alignment E=3.4e-10 PF12806: Acyl-CoA_dh_C" amino acids 469 to 588 (120 residues), 59.5 bits, see alignment E=1.1e-19

Best Hits

KEGG orthology group: K00257, [EC: 1.3.99.-] (inferred from 100% identity to atu:Atu0732)

Predicted SEED Role

"Acyl-CoA dehydrogenase (EC 1.3.8.7)" (EC 1.3.8.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.8.7, 1.3.99.-

Use Curated BLAST to search for 1.3.8.7 or 1.3.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJZ4 at UniProt or InterPro

Protein Sequence (594 amino acids)

>Atu0732 acyl-CoA dehydrogenase (Agrobacterium fabrum C58)
MYSAPVDDIAFTLKHVAGLEDALSQGVLGDLSEDLVDAILEEAGRFATGEVAPLADIGDR
QGAKLADGKVTTPDGWADLYRRWAEAGWNSLTAPEEFGGQNLPHMLNVAALEMWNSGSMA
FALAPTLTMGAVEAIVTHGSNDLKRIYLPKLVSGEWTGTMNLTEPHAGSDLGVLKTRAER
NGDGTYRIFGQKIFITWGEHDAADNIIHLVLARLPDAPTGTRGISLFLVPKFLPDENGAP
GSRNDLFCHSLEHKLGIHGSPTCTMIFGDGKFGDEKGALGWLIGEENKGLACMFTMMNNA
RLAVGMQGVAICEAATQKAIEYAKERTQGKAPGWQGSGMSPIIEHPDIARTLLTMKALTQ
GSRAISFSCAHAIDMAHATEDASQRAHWQERAALLTPIAKSFSTDAGVDVASMGIQVHGG
MGFIEETGAARYLRDARIAPIYEGTNGIQAIDLVLRKLPLSEGAQVRGFIAELREIAART
AASNRDDLGETARYLEASLNDLETTTDWLLSRIKAGETETALAGATAYQRLFGLALTGAY
LAKGALVSVDDGRSGHRAALCRFTAENLLAETAALKDRVISGAASLAAARTLLA