Protein Info for Atu0727 in Agrobacterium fabrum C58

Annotation: ferredoxin I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 PF00970: FAD_binding_6" amino acids 2 to 70 (69 residues), 27.9 bits, see alignment E=5.1e-10 PF00175: NAD_binding_1" amino acids 80 to 186 (107 residues), 50.5 bits, see alignment E=6.3e-17 PF00111: Fer2" amino acids 233 to 302 (70 residues), 52.9 bits, see alignment E=5.9e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu0727)

MetaCyc: 53% identical to stachydrine N-demethylase reductase subunit (Sinorhizobium meliloti 1021)
R501-RXN [EC: 1.14.13.247]

Predicted SEED Role

"Flavodoxin reductases (ferredoxin-NADPH reductases) family 1" in subsystem Anaerobic respiratory reductases

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.247

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJZ6 at UniProt or InterPro

Protein Sequence (310 amino acids)

>Atu0727 ferredoxin I (Agrobacterium fabrum C58)
MPGQFVTLELPVGSEPIYRTYTLSSSPSRPYALSVTVKAQATSIGTRWMFDNLKPGMKVR
ALGPLGDFSYVKHPGDKYLFISAGSGVTPMMSMVRDMSDRAPQSDITFINCSRTPGDIVF
RHELEYLARFMPNLSLGFIVEKCGRTDLWSGLRGMVDKAKIALLAHDFMDRTVFCCGPEP
FMAAVRSMLDASGFDMSRYHQESFAPAAPVSVGETVLTGADGEALSMVGFTLSGKELPCQ
PGQTVLMTARAAGVRIGAACESGICGTCRVLKLSGEVEMNHNGGILDEEIEEGYILACCS
RPLTDIKVEA