Protein Info for Atu0726 in Agrobacterium fabrum C58

Annotation: ring hydroxylating dioxygenase, alpha-subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00355: Rieske
  • amino acids 43 to 121 (79 residues), 67.4 bits, E=8.2e-23
• PF00848: Ring_hydroxyl_A
  • amino acids 178 to 399 (222 residues), 126.7 bits, E=1.3e-40

Best Hits

KEGG orthology group: K00479, Rieske 2Fe-2S family protein (inferred from 100% identity to atu:Atu0726)

MetaCyc: 58% identical to stachydrine N-demethylase oxygenase subunit (Sinorhizobium meliloti 1021)
R501-RXN [EC: 1.14.13.247]

Predicted SEED Role

"Benzoate 1,2-dioxygenase (EC 1.14.12.10)" (EC 1.14.12.10)

MetaCyc Pathways

• proline betaine degradation I (2/3 steps found)
• benzoate degradation I (aerobic) (1/2 steps found)
• meta cleavage pathway of aromatic compounds (4/10 steps found)
• toluene degradation IV (aerobic) (via catechol) (5/13 steps found)
• mandelate degradation to acetyl-CoA (8/18 steps found)
• superpathway of aerobic toluene degradation (12/30 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (15/35 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (11/42 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Fluorobenzoate degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.12.10 or 1.14.13.247

Sequence Analysis Tools

See A9CJZ7 at UniProt or InterPro

Protein Sequence (414 amino acids)

>Atu0726 ring hydroxylating dioxygenase, alpha-subunit (Agrobacterium fabrum C58)
MELRDTVLRQLKNRREGFSLEQPFYTDPDYFKLDMETIWYRDWLFVGHDCEVPKSGNYMT
VQVGAYSVVIVRGRDGQIRALQNSCRHRGSRVCSAQKGQAARLVCPYHQWTYDLDGKLLF
ARHMGEEFDKAEFGLKPVACETVAGYVFICLADQPADFAPMRAEVESYMAPHRIWEAKVA
HESTIIEKGNWKLVWENNRECYHCAANHPELCRTYPENPSVTGTDGGASDPEIGGHWARC
EAAGLPSRFKIDPKGQFRVARMPLIGEAESYTMSGKRAVRRPLSEDVSISHIGALLLFHY
PTTWNHFLGDHTISFRVLPLNANETMVTTKWLVHKDAVEGVDYDLEDLTHVWNETNDQDR
RIVEENAFGIRSPAYQPGPYSMEDEGGVMQFVNWYSDFMVDRLSGDKARLSAVA