Protein Info for Atu0726 in Agrobacterium fabrum C58

Annotation: ring hydroxylating dioxygenase, alpha-subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 PF00355: Rieske" amino acids 43 to 119 (77 residues), 62.8 bits, see alignment E=2.3e-21 PF00848: Ring_hydroxyl_A" amino acids 180 to 399 (220 residues), 115.9 bits, see alignment E=2.5e-37

Best Hits

KEGG orthology group: K00479, Rieske 2Fe-2S family protein (inferred from 100% identity to atu:Atu0726)

MetaCyc: 58% identical to stachydrine N-demethylase oxygenase subunit (Sinorhizobium meliloti 1021)
R501-RXN [EC: 1.14.13.247]

Predicted SEED Role

"Benzoate 1,2-dioxygenase (EC 1.14.12.10)" (EC 1.14.12.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.12.10 or 1.14.13.247

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CJZ7 at UniProt or InterPro

Protein Sequence (414 amino acids)

>Atu0726 ring hydroxylating dioxygenase, alpha-subunit (Agrobacterium fabrum C58)
MELRDTVLRQLKNRREGFSLEQPFYTDPDYFKLDMETIWYRDWLFVGHDCEVPKSGNYMT
VQVGAYSVVIVRGRDGQIRALQNSCRHRGSRVCSAQKGQAARLVCPYHQWTYDLDGKLLF
ARHMGEEFDKAEFGLKPVACETVAGYVFICLADQPADFAPMRAEVESYMAPHRIWEAKVA
HESTIIEKGNWKLVWENNRECYHCAANHPELCRTYPENPSVTGTDGGASDPEIGGHWARC
EAAGLPSRFKIDPKGQFRVARMPLIGEAESYTMSGKRAVRRPLSEDVSISHIGALLLFHY
PTTWNHFLGDHTISFRVLPLNANETMVTTKWLVHKDAVEGVDYDLEDLTHVWNETNDQDR
RIVEENAFGIRSPAYQPGPYSMEDEGGVMQFVNWYSDFMVDRLSGDKARLSAVA