Protein Info for Atu0715 in Agrobacterium fabrum C58

Annotation: ATP synthase epsilon chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 50 to 73 (24 residues), see Phobius details PF00137: ATP-synt_C" amino acids 9 to 71 (63 residues), 46.6 bits, see alignment E=1.7e-16

Best Hits

Swiss-Prot: 62% identical to ATPL_PELUB: ATP synthase subunit c (atpE) from Pelagibacter ubique (strain HTCC1062)

KEGG orthology group: K02110, F-type H+-transporting ATPase subunit c [EC: 3.6.3.14] (inferred from 100% identity to agr:AGROH133_04304)

MetaCyc: 39% identical to ATP synthase Fo, c subunit (Synechococcus elongatus PCC 7942 = FACHB-805)

Predicted SEED Role

"ATP synthase F0 sector subunit c"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CK02 at UniProt or InterPro

Protein Sequence (75 amino acids)

>Atu0715 ATP synthase epsilon chain (Agrobacterium fabrum C58)
MEAEAAKYIGAGLACLGMAGTSLALGRIFGDYLSGALRNPSAADSQFGRLVFGFAVTEAL
GIFSLLVALLLLFAV