Protein Info for Atu0713 in Agrobacterium fabrum C58

Annotation: ATP synthase, subunit I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 121 transmembrane" amino acids 50 to 70 (21 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details PF09527: ATPase_gene1" amino acids 44 to 96 (53 residues), 57.6 bits, see alignment E=5.2e-20

Best Hits

KEGG orthology group: K02116, ATP synthase protein I (inferred from 100% identity to atu:Atu0713)

Predicted SEED Role

"ATP synthase protein I" in subsystem F0F1-type ATP synthase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CK04 at UniProt or InterPro

Protein Sequence (121 amino acids)

>Atu0713 ATP synthase, subunit I (Agrobacterium fabrum C58)
MTGNRDDSLDERRKRLADELAKVKAEDEADVRAETNAAENRKGFAMAVKLSSEFISAIVV
GAMLGYLLDYFVGTTPWGMIVLLLLGFCAGVLNVLRSTGAVAKPPLLEKADRQDEGGKGG
A