Protein Info for Atu0705 in Agrobacterium fabrum C58

Annotation: 3-oxoacyl-(acyl carrier protein) reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF00106: adh_short" amino acids 17 to 206 (190 residues), 151.7 bits, see alignment E=2.8e-48 PF08659: KR" amino acids 17 to 170 (154 residues), 34.6 bits, see alignment E=2.8e-12 PF13561: adh_short_C2" amino acids 24 to 256 (233 residues), 177.1 bits, see alignment E=7e-56

Best Hits

Swiss-Prot: 61% identical to GALD_RHIME: Probable galactose dehydrogenase GalD (galD) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to atu:Atu0705)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CK07 at UniProt or InterPro

Protein Sequence (257 amino acids)

>Atu0705 3-oxoacyl-(acyl carrier protein) reductase (Agrobacterium fabrum C58)
MTPMMQAQFPDLKDAGVLVTGGGSGIGASLVEAFAMQGAKVSFIDIAEQPSIALVERLAA
TVPHPVHYFRADLSDIDAIKRTVDMAASATGGIKVLVNNAAWDDRHDIDSVTEAYWDANQ
AVNLKQMFFTVQAALPHLRQAKDASIVNFSSISFLLNMGELPSYAAAKAGIIGLTKSLAG
RLGPENIRVNTLLPGMIVTERQKELWLTDEGITATTARQCLKRTLVAADLSGPCLFLASS
ASSAITAQSIIVDGGLL