Protein Info for Atu0701 in Agrobacterium fabrum C58

Annotation: GGDEF family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 16 to 180 (165 residues), 95.8 bits, see alignment E=1.1e-31 PF00990: GGDEF" amino acids 20 to 176 (157 residues), 113.5 bits, see alignment E=9e-37 PF00563: EAL" amino acids 197 to 428 (232 residues), 234 bits, see alignment E=1.7e-73

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu0701)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CK09 at UniProt or InterPro

Protein Sequence (450 amino acids)

>Atu0701 GGDEF family protein (Agrobacterium fabrum C58)
MKRAEPQSLQVSQNELQAMAYSDPLTGLGNRYRLRDKIRMLASERSSDPAPFTVGIANID
GFKPINDLFGVQAGDEILCQVAHRLKACIPDGAIVTRHDGDEFAFVLPLIFERIGAERIG
NMIKDVLSAPYDLGDRNVRLSSSFGFAIYPFAGDEYEDLLKSAETALYRSKRRGRGQITV
YSREIAQEMKRATQLEQALRNAIITDAIDVHFQPIVRLEEAKVIGFEALARWNDPDLGFV
SPAVFVPLAEERGFIDALSEALLRKAAEAALFWPRELFLSFNLSSAQLMDPSTSDNILSI
LSRVGLDPHRLELEITETAVMTSADTAQRIISELQSAGVRISLDDFGTGQSSLGRLRDFT
FDKVKIDRAFVSRISSDRPSEHIIKAIVAMCEGLDLEVVAEGIEERVEEEKLRALGCAMG
QGYFYGRPVDAAATQRYLHENYREILSDIS