Protein Info for Atu0684 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 TIGR01459: HAD hydrolase, TIGR01459 family" amino acids 9 to 243 (235 residues), 146.4 bits, see alignment E=9.5e-47 PF13344: Hydrolase_6" amino acids 18 to 115 (98 residues), 64.9 bits, see alignment E=8.7e-22 TIGR01460: HAD hydrolase, family IIA" amino acids 18 to 246 (229 residues), 149.1 bits, see alignment E=1.9e-47 PF13242: Hydrolase_like" amino acids 192 to 253 (62 residues), 34.9 bits, see alignment E=1.8e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu0684)

Predicted SEED Role

"HAD superfamily protein involved in N-acetyl-glucosamine catabolism"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D0X9 at UniProt or InterPro

Protein Sequence (282 amino acids)

>Atu0684 hypothetical protein (Agrobacterium fabrum C58)
MAHRILTLGEITDGFDVVLSDVWGVLHNGVSAFPDAAVALHEARKAGKTVVLITNSPRPA
PGVIAQLRVLGVPDEAYDRIITSGDVTRGLIAEGPKKVFLLGPERDMPLLEGLDVERVGE
AEAQSVVCTGFFDDETETPEDYTEMLKGFIARKVPMICANPDLVVERGERIIPCAGAMAA
YYEQLGGEVRIAGKPHAPIYEACLAAAKDVRGAFAKDRVLAIGDGMPTDVKGAIASGLNL
LYISGGIHAAEYTLNGQTDEALLNAYLKGQGAAPGWWMPRLA