Protein Info for Atu0680 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 88 to 113 (26 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details PF07291: MauE" amino acids 21 to 102 (82 residues), 39.4 bits, see alignment E=7.4e-14 PF07681: DoxX" amino acids 24 to 104 (81 residues), 76.2 bits, see alignment E=2.6e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu0680)

Predicted SEED Role

"Mll8168 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CK19 at UniProt or InterPro

Protein Sequence (163 amino acids)

>Atu0680 hypothetical protein (Agrobacterium fabrum C58)
MQLIGDTPITYRRYSMSSSQNALVLIARILLSFIFIYSGFGKLTDPAGTAGMIAGAGMPA
ATALAYLAGLFELVAGLAILAGFQTKIAAWALAVFCVFTGLVFHSGTVAVPGWPEPALGW
INTLNGIMMMKNITLAGAYILLATFGAGAYSVDAKRGFVAARA