Protein Info for Atu0676 in Agrobacterium fabrum C58

Annotation: histidyl-tRNA synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 507 TIGR00442: histidine--tRNA ligase" amino acids 15 to 459 (445 residues), 383.6 bits, see alignment E=5.9e-119 PF13393: tRNA-synt_His" amino acids 18 to 363 (346 residues), 149.1 bits, see alignment E=3.6e-47 PF01409: tRNA-synt_2d" amino acids 24 to 141 (118 residues), 20.7 bits, see alignment E=5.3e-08 PF00587: tRNA-synt_2b" amino acids 78 to 367 (290 residues), 34 bits, see alignment E=6.4e-12 PF03129: HGTP_anticodon" amino acids 384 to 466 (83 residues), 39.2 bits, see alignment E=1.3e-13

Best Hits

Swiss-Prot: 100% identical to SYH_AGRFC: Histidine--tRNA ligase (hisS) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01892, histidyl-tRNA synthetase [EC: 6.1.1.21] (inferred from 100% identity to atu:Atu0676)

Predicted SEED Role

"Histidyl-tRNA synthetase (EC 6.1.1.21)" (EC 6.1.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UHK4 at UniProt or InterPro

Protein Sequence (507 amino acids)

>Atu0676 histidyl-tRNA synthetase (Agrobacterium fabrum C58)
MSEKAKKPQKLKARLPRGFVDRSAADIHATNEMVDKIRRVYELYGFDPIETPLFEYTDAL
GKFLPDSDRPNEGVFSLQDDDDQWMSLRYDLTAPLARHVAENFNEIQLPYRTYRAGYVFR
NEKPGPGRFRQFMQFDADTVGAAGVQADAEMCMMMADTMEALGIARGDYVIRVNNRKVLD
GVMEAIGLGGEDNAGRRLNVLRAIDKLDKFGPEGVKLLLGPGRKDESGDFTKGAGLGDEQ
IEKVLFFVGIKDYAASADDLAKLVAGTSKGEEGVDELNTIGALVSGAGYDATRIKIDPSV
VRGLEYYTGPVYEAELTFDVTNEKGEKVVFGSVGGGGRYDGLVSRFMGQPVPATGFSIGV
SRLMTALKNLGKLGQVKPLAPVLITVMDGDVESMGRYQRFTQALRAEGIRAEMYQGNWKK
FGNQLKYADRLGSPIAIIQGGDERAEGVVQIKDLIEGKRLSGEIEDNASWREARVAQVSV
PEAELVAKVREILEHQAEDVRRAAEGR