Protein Info for Atu0660 in Agrobacterium fabrum C58

Annotation: hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF05116: S6PP" amino acids 5 to 244 (240 residues), 257.4 bits, see alignment E=1.5e-80 TIGR01484: HAD hydrolase, family IIB" amino acids 6 to 202 (197 residues), 51.8 bits, see alignment E=5.6e-18 PF08282: Hydrolase_3" amino acids 111 to 237 (127 residues), 45.3 bits, see alignment E=9.6e-16

Best Hits

Swiss-Prot: 100% identical to MFPP_AGRFC: Mannosylfructose-phosphate phosphatase (mfppA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K13086, mannosylfructose-6-phosphate phosphatase [EC: 3.1.3.79] (inferred from 100% identity to atu:Atu0660)

MetaCyc: 100% identical to mannosylfructose-phosphate phosphatase (Agrobacterium fabrum C58)
Mannosylfructose-phosphate phosphatase. [EC: 3.1.3.79]

Predicted SEED Role

"Mannosylfructose-phosphate phosphatase mfppA"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CK30 at UniProt or InterPro

Protein Sequence (248 amino acids)

>Atu0660 hydrolase (Agrobacterium fabrum C58)
MKPLRLLSTDLDGTVVGDNDATRRFRDFWHALPDDLRPVLVFNSGRLIDDQLALLEEVPL
PQPDYIIGGVGTMLHAKKRSELETAYTQSLGTGFDPRKIADVMNRIAGVTMQEERYQHGL
KSSWFLHDADAAALGEIEAALLAADIDARIVYSSDRDLDILPKAADKGAALAWLCGQLRI
GLDESVVSGDTGNDRAMFELKTIRGVIVGNALPELVSLAHQDNRFFHSTAKEADGVIEGL
RHWGLNPR