Protein Info for Atu0658 in Agrobacterium fabrum C58

Annotation: phosphate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 501 transmembrane" amino acids 34 to 55 (22 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 96 to 118 (23 residues), see Phobius details amino acids 139 to 158 (20 residues), see Phobius details amino acids 167 to 185 (19 residues), see Phobius details amino acids 196 to 218 (23 residues), see Phobius details amino acids 235 to 255 (21 residues), see Phobius details amino acids 262 to 282 (21 residues), see Phobius details amino acids 302 to 321 (20 residues), see Phobius details amino acids 349 to 368 (20 residues), see Phobius details amino acids 388 to 406 (19 residues), see Phobius details amino acids 412 to 429 (18 residues), see Phobius details amino acids 471 to 496 (26 residues), see Phobius details PF01384: PHO4" amino acids 78 to 489 (412 residues), 351.6 bits, see alignment E=2.2e-109

Best Hits

KEGG orthology group: K03306, inorganic phosphate transporter, PiT family (inferred from 100% identity to atu:Atu0658)

Predicted SEED Role

"Probable low-affinity inorganic phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CK32 at UniProt or InterPro

Protein Sequence (501 amino acids)

>Atu0658 phosphate permease (Agrobacterium fabrum C58)
MATKPPSNMKPTLDKDLDKITRVEEATLHVTQQLAGLGAGFMFVVLAAVFAGAFVTGTAG
SVIIIAAVALGAYMAINIGANDVTNNVGPAVGAKAMPLAVALIVAAICEIAGALITGGNV
VETISSGIINVETIPDRTAFSWAMLSALLAAGLLVNISTWTRAPISTTHTVVGGVAGAGM
AAYGAKAVEWLSLGSIAFAWVLAPFISAAIAIAILTFIKEFIVYRDDKIDAARRWVPVLI
GLMAGVFMAYLIWVGLRQLMHVSLGHASIIGLVTGLLAWRLCVPIIRKQSEGLENRNQSL
RILFQWPLVLAAGLMSFAHGANDVSNAIGPVVAIVRALHDEAVQTSARAPLWVMLVGAFG
LSCGILLYGPRLIRLVGEQITKLNPMRAFCVSVATALTVLVASRFGLPVSTTHTAIGAVF
GVGFFREWYTQASRRRQELVQSGTGEPRRTPRYLDNPSEVRRRYLVRRSHFMTIIAAWVV
TVPASATLAALLYWLLSFLFL