Protein Info for Atu0649 in Agrobacterium fabrum C58

Annotation: cyclopropane-fatty-acyl-phospholipid synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 PF02353: CMAS" amino acids 116 to 380 (265 residues), 294 bits, see alignment E=3.1e-91 PF13489: Methyltransf_23" amino acids 165 to 295 (131 residues), 34.5 bits, see alignment E=4.9e-12 PF13847: Methyltransf_31" amino acids 172 to 280 (109 residues), 43.8 bits, see alignment E=6.7e-15 PF13649: Methyltransf_25" amino acids 176 to 272 (97 residues), 62.6 bits, see alignment E=1.4e-20 PF08242: Methyltransf_12" amino acids 177 to 273 (97 residues), 39.5 bits, see alignment E=2.4e-13 PF08241: Methyltransf_11" amino acids 177 to 275 (99 residues), 44.4 bits, see alignment E=6.4e-15

Best Hits

KEGG orthology group: K00574, cyclopropane-fatty-acyl-phospholipid synthase [EC: 2.1.1.79] (inferred from 100% identity to atu:Atu0649)

Predicted SEED Role

"Cyclopropane-fatty-acyl-phospholipid synthase (EC 2.1.1.79)" (EC 2.1.1.79)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.79

Use Curated BLAST to search for 2.1.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CK38 at UniProt or InterPro

Protein Sequence (418 amino acids)

>Atu0649 cyclopropane-fatty-acyl-phospholipid synthase (Agrobacterium fabrum C58)
MASSLHVLLEKIIKIGDLTVNSPGGSRTFGDGTGKKVVLNFTDEAAMQEIAADPALKLAE
MYMEGRAKVAKGDIYDFLALVKGNTLSEALSFGMIWRGMARIIAARIKMRLPVNHNKSNV
AHHYDLSAKLFDLFLDEDWQYSCAYFNPPDIGLYEAQVAKKRHIAAKLMTEPGQSVLEIG
SGWGGMAMYIAESAGADVTGITLSEEQLRVSRDRAAKRGLAGNVRFELQDYRYLPASKKY
DRIVSVGMFEHVGPTHYRDYFDKVAEVLDDKGVMVLHSIGQPYPALATNPFIEKYIFPGG
YIPSLAEVLPAIQKSGLLVKDIEILPMHYAHTLRHWRERFVARKAEAVALYDERFFRMWE
FYLAGSEMAFTHENFHIFQIQLAKDRDAVPHNRDYIAQNEAKLLEFEKTRPPLEKVSF