Protein Info for Atu0633 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 614 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF14559: TPR_19" amino acids 65 to 111 (47 residues), 27.3 bits, see alignment 2.6e-09 PF13181: TPR_8" amino acids 392 to 420 (29 residues), 12.4 bits, see alignment (E = 0.00011) amino acids 432 to 462 (31 residues), 15.2 bits, see alignment (E = 1.4e-05) amino acids 505 to 530 (26 residues), 15.7 bits, see alignment (E = 9.4e-06) PF07719: TPR_2" amino acids 432 to 462 (31 residues), 28.2 bits, see alignment (E = 9.2e-10) PF13174: TPR_6" amino acids 432 to 462 (31 residues), 12.6 bits, see alignment (E = 0.00013) PF00515: TPR_1" amino acids 432 to 462 (31 residues), 31.3 bits, see alignment (E = 8.8e-11) PF13432: TPR_16" amino acids 435 to 497 (63 residues), 20.4 bits, see alignment E=3.9e-07 amino acids 505 to 562 (58 residues), 23.5 bits, see alignment 4.4e-08

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu0633)

Predicted SEED Role

"FIG140336: TPR domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D123 at UniProt or InterPro

Protein Sequence (614 amino acids)

>Atu0633 hypothetical protein (Agrobacterium fabrum C58)
MRRKPALRLLCSAALAAALAIGAGASPGFAETKAKPEDKAVTFDPGKVNTFSGAFLAGRN
ADVDQDYPTAISLYKKALEYDPANSEIRQRLMIAELLSGNFEAGAKIADSMKDDTSVERV
TTIVRGLDAIKDKEFTKAEKILKYTGPNDLDRMVNTLLTAWARAGSGKPKEALALVNNMK
GPGWISIFQKYNAAAIALVSGNTEAARKSLNEAVTDREGGATASDTYMRAVMALARLEAS
AGNKQKALDAIAVGDTFAPNYAPLKALREAIEKGEKPEQQITNAVEGAASVMFSIAGALN
REGAEEIVTLYLQTSRALDPKSPDTLILLGGLAEAMKQPERAITFYREVPKDSPMHRISE
LQLGLTLAQTGKVEESRKHLLSLLESDPKDIRSYLAYGSVLSDAKDYKAMAENYDKAVEV
IGAVPQKSDWSVFFQRGIAYERLKQWDKAEPNFKRALELNPEQPQVLNYLGYSWVDKGIN
LDEGMKMISRAVELRPNDGYIVDSLGWAHYRLGDFDQSVTELERAIELKAGDPTINDHLG
DAYWRVGRKIEAVYQWNRALIGDNDDVDKAKVKEKIANGLPPVEKDAENTAKKDVAPQPP
APPAPATPTPDKKS