Protein Info for Atu0632 in Agrobacterium fabrum C58

Annotation: 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00154: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
  • amino acids 12 to 281 (270 residues), 184.8 bits, E=1.3e-58
• PF00288: GHMP_kinases_N
  • amino acids 78 to 158 (81 residues), 53.3 bits, E=2.6e-18
• PF08544: GHMP_kinases_C
  • amino acids 226 to 287 (62 residues), 42.4 bits, E=7.6e-15

Best Hits

Swiss-Prot: 100% identical to ISPE_AGRFC: 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (ispE) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00919, 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC: 2.7.1.148] (inferred from 100% identity to atu:Atu0632)

Predicted SEED Role

"4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC 2.7.1.148)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 2.7.1.148)

MetaCyc Pathways

• methylerythritol phosphate pathway II (8/9 steps found)
• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (10/12 steps found)
• taxadiene biosynthesis (engineered) (10/13 steps found)
• methylerythritol phosphate pathway I (7/9 steps found)
• isoprene biosynthesis I (7/10 steps found)
• superpathway of ergosterol biosynthesis II (9/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.148

Sequence Analysis Tools

See Q8UHP8 at UniProt or InterPro

Protein Sequence (299 amino acids)

>Atu0632 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (Agrobacterium fabrum C58)
MRLHEVSGATETVEAAPAKINLALHVTGQRADGYHLLETLVTFTAAGDMIRIRDAATDSF
SISGPFGDLLSAGDSGDNLVTRARDILRDALASTGQPARPVDIHLEKNLPVASGIGGGSA
DAAATLRGLLRHWDAAIAPEKLKSLALKLGADVPMCLASRPLIARGIGEDIEALTDLPEL
SMVLANPLKAVSTPEIFRRLQNKVNPHLPTPSTIGWATTGWMDFLAQSRNDLQPPAQALL
PEIGEITGLLSEEGATLVRMSGSGATCFGIFHSFDAAKNAETSLRKKRPGWYFHATRTI