Protein Info for Atu0624 in Agrobacterium fabrum C58

Annotation: inosine-5`-monophosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00478: IMPDH
  • amino acids 1 to 442 (442 residues), 477 bits, E=6.6e-147
• TIGR01302: inosine-5'-monophosphate dehydrogenase
  • amino acids 1 to 424 (424 residues), 596.9 bits, E=1.3e-183
• PF00571: CBS
  • amino acids 54 to 110 (57 residues), 43.3 bits, 7.5e-15
  • amino acids 118 to 170 (53 residues), 32.1 bits, 2.4e-11
• PF00977: His_biosynth
  • amino acids 172 to 332 (161 residues), 25.8 bits, E=1.4e-09
• PF03060: NMO
  • amino acids 184 to 341 (158 residues), 31.1 bits, E=3.4e-11

Best Hits

Swiss-Prot: 56% identical to IMDH_ACICA: Inosine-5'-monophosphate dehydrogenase (guaB) from Acinetobacter calcoaceticus

KEGG orthology group: K00088, IMP dehydrogenase [EC: 1.1.1.205] (inferred from 100% identity to atu:Atu0624)

MetaCyc: 40% identical to inosine-5'-monophosphate dehydrogenase 1 monomer (Homo sapiens)
IMP dehydrogenase. [EC: 1.1.1.205]

Predicted SEED Role

"Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205)" in subsystem Purine conversions (EC 1.1.1.205)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• purine nucleotides degradation II (aerobic) (11/11 steps found)
• superpathway of purine nucleotide salvage (13/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• purine nucleotides degradation I (plants) (10/12 steps found)
• adenosine nucleotides degradation I (7/8 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• inosine 5'-phosphate degradation (4/4 steps found)
• ureide biosynthesis (6/7 steps found)
• superpathway of purines degradation in plants (12/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.205

Sequence Analysis Tools

See Q7D130 at UniProt or InterPro

Protein Sequence (457 amino acids)

>Atu0624 inosine-5`-monophosphate dehydrogenase (Agrobacterium fabrum C58)
MNLPILSSAMDTVTEGRLAIAMAQAGGIGVIHRNLTPIEQAEEVRQVKKFESGMVVNPVT
IGPDATLAEAQALMKAHGISGIPVVENGGAGGHKNGRLVGILTNRDVRFASDPQQKIYEL
MTRENLVTVKESSVDQQEARRLLHKHRIEKLLVVDGKGNCVGLITVKDIEKSQLNPNATK
DAQGRLRAAAAISVGADAIERAERLIDAGVDLLVVDTAHGHSQRVLDAVAQVKKMSNSVR
IIAGNVATADGTKALIDAGADAVKVGIGPGSICTTRIVAGVGVPQLAAVMAAVEAASLAD
IPVIADGGIKFSGDLAKAIAAGASAVMIGSLLAGTDESPGEVFLYQGRSFKAYRGMGSVG
AMARGSADRYFQAEVRDTLKLVPEGIEGQVPYKGPVSGVLHQLAGGLKAAMGYVGGSNIK
EFQERATFVRISSAGLRESHAHDVTITRESPNYPGAV