Protein Info for Atu0624 in Agrobacterium fabrum C58

Annotation: inosine-5`-monophosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 PF00478: IMPDH" amino acids 1 to 442 (442 residues), 477 bits, see alignment E=6.6e-147 TIGR01302: inosine-5'-monophosphate dehydrogenase" amino acids 1 to 424 (424 residues), 596.9 bits, see alignment E=1.3e-183 PF00571: CBS" amino acids 54 to 110 (57 residues), 43.3 bits, see alignment 7.5e-15 amino acids 118 to 170 (53 residues), 32.1 bits, see alignment 2.4e-11 PF00977: His_biosynth" amino acids 172 to 332 (161 residues), 25.8 bits, see alignment E=1.4e-09 PF03060: NMO" amino acids 184 to 341 (158 residues), 31.1 bits, see alignment E=3.4e-11

Best Hits

Swiss-Prot: 56% identical to IMDH_ACICA: Inosine-5'-monophosphate dehydrogenase (guaB) from Acinetobacter calcoaceticus

KEGG orthology group: K00088, IMP dehydrogenase [EC: 1.1.1.205] (inferred from 100% identity to atu:Atu0624)

MetaCyc: 40% identical to inosine-5'-monophosphate dehydrogenase 1 monomer (Homo sapiens)
IMP dehydrogenase. [EC: 1.1.1.205]

Predicted SEED Role

"Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205)" in subsystem Purine conversions (EC 1.1.1.205)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.205

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D130 at UniProt or InterPro

Protein Sequence (457 amino acids)

>Atu0624 inosine-5`-monophosphate dehydrogenase (Agrobacterium fabrum C58)
MNLPILSSAMDTVTEGRLAIAMAQAGGIGVIHRNLTPIEQAEEVRQVKKFESGMVVNPVT
IGPDATLAEAQALMKAHGISGIPVVENGGAGGHKNGRLVGILTNRDVRFASDPQQKIYEL
MTRENLVTVKESSVDQQEARRLLHKHRIEKLLVVDGKGNCVGLITVKDIEKSQLNPNATK
DAQGRLRAAAAISVGADAIERAERLIDAGVDLLVVDTAHGHSQRVLDAVAQVKKMSNSVR
IIAGNVATADGTKALIDAGADAVKVGIGPGSICTTRIVAGVGVPQLAAVMAAVEAASLAD
IPVIADGGIKFSGDLAKAIAAGASAVMIGSLLAGTDESPGEVFLYQGRSFKAYRGMGSVG
AMARGSADRYFQAEVRDTLKLVPEGIEGQVPYKGPVSGVLHQLAGGLKAAMGYVGGSNIK
EFQERATFVRISSAGLRESHAHDVTITRESPNYPGAV